Bacteriome.org

Gene Details

gene name: thrA

Phylogenetic Profile Distribution

locus tag k12	ECK0002	information on phylogenetic profile
locus tag mg1655	b0002
locus tag w3110	JW0001
gene name k12	thrA
locus name	thrA
synonyms of locus name	Hs, thrA1, thrA2, thrD

scop id	55347; 51735; 53633
superfamily	Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain; NAD(P)-binding Rossmann-fold domains; Carbamate kinase-like
pfam id	PF01842; PF00696; PF00742; PF03447
pfam domain	ACT domain; Amino acid kinase family; Homoserine dehydrogenase; Homoserine dehydrogenase, NAD binding d
tigrfam id	TIGR00657
name	asp_kinases
function	aspartate kinase

swissprot name	AK1H_ECOLI
description	Bifunctional aspartokinase/homoserine dehydrogenase I (AKI-HDI)\|[Includes: Aspartokinase I (EC 2.7.2.4); Homoserine dehydrogenase I\|(EC 1.1.1.3)].
seq length	820
fastaseq	MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIP ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD EDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVIGVGGVGGAL LEQLKRQQSWLKNKHIDLRVCGVANSKALLTNVHGLNLENWQEELAQAKEPFNLGRLIRL VKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVTPNKKANTSSMDYYHQLRYAAEKSR RKFLYDTNVGAGLPVIENLQNLLNAGDELMKFSGILSGSLSYIFGKLDEGMSFSEATTLA REMGYTEPDPRDDLSGMDVARKLLILARETGRELELADIEIEPVLPAEFNAEGDVAAFMA NLSQLDDLFAARVAKARDEGKVLRYVGNIDEDGVCRVKIAEVDGNDPLFKVKNGENALAF YSHYYQPLPLVLRGYGAGNDVTAAGVFADLLRTLSWKLGV

go id	GO:0005737; GO:0009088; GO:0009086; GO:0009090
go term	cytoplasm; threonine biosynthesis; methionine biosynthesis; homoserine biosynthesis

gene product description	fused aspartokinase I; homoserine dehydrogenase I
comment gene product description	threonine sensitive
evidence	E
context
gene product desc	Enzyme
cell location	Cytoplasmic
features	CDS

functional category code	E
functional category	Amino acid transport and metabolism

reference #1	PROSITE: a dictionary of sites and patterns in proteins. Bairoch A.
reference #2	Fine structure analysis of the threonine operon in Escherichia coli K-12. Saint-Girons I., Margarita D. (Mol Gen Genet. 1978 Jun 1; 162(1):101-7)
reference #3	Aspartokinase I-homoserine dehydrogenase I of Escherichia coli K12. Concentration-dependent dissociation to dimers in the presence of L-threonine. Vickers L., Ackers G., Ogilvie J. (J Biol Chem. 1978 Apr 10; 253(7):2155-60)
reference #4	Interaction of aspartate and aspartate-derived antimetabolites with the enzymes of the threonine biosynthetic pathway of Escherichia coli. Shames S., Ash D., Wedler F., Villafranca J. (J Biol Chem. 1984 Dec 25; 259(24):15331-9)
reference #5	Allosteric transition of aspartokinase I-homoserine dehydrogenase I studied by time-resolved fluorescence. Jullien M., Baudet S., Rodier F., Le Bras G. (Biochimie. 1988 Dec; 70(12):1807-14)
reference #6	The primary structure of Escherichia coli K 12 aspartokinase I-homoserine dehydrogenase I : sequence of cyanogen bromide peptide CB 3. Sibilli L., Le Bras G., Cossart P., Chalvignac M., Le Bras G., Briley P., Cohen G. (Biochimie. 1979; 61(5-6):733-9)
reference #7	Construction and expression of a hybrid plasmid containing the Escherichia coli thrA and thrB genes. Cossart P., Katinka M., Yaniv M., Saint Girons I., Cohen G. (Mol Gen Genet. 1979 Aug; 175(1):39-44)
reference #8	Nucleotide sequence of the metL gene of Escherichia coli. Its product, the bifunctional aspartokinase ii-homoserine dehydrogenase II, and the bifunctional product of the thrA gene, aspartokinase I-homoserine dehydrogenase I, derive from a common ancestor. Zakin M., Duchange N., Ferrara P., Cohen G. (J Biol Chem. 1983 Mar 10; 258(5):3028-31)
reference #9	Nucleotide sequence of the thrA gene of Escherichia coli. Katinka M., Cossart P., Sibilli L., Saint-Girons I., Chalvignac M., Le Bras G., Cohen G., Yaniv M. (Proc Natl Acad Sci U S A. 1980 Oct; 77(10):5730-3)

phylogenetic profile


118	84	134	145	230	106	103	279	257	263	253	253	88	113	97	102	72	66	1	105
149	154	157	140	128	128	128	128	150	150	139	147	141	134	133	159	140	150	146	152
151	160	136	155	133	124	123	157	108	132	132	132	134	134	156	145	145	147	136	137
129	115	137	152	149	124	144	162	73	139	164	169	149	160	160	166	149	146	151	183
165	160	143	124	137	173	1	162	134	149	150	149	142	149	1	1	1	1	1	1
1	1	164	1	151	151	151	151	151	156	156	150	161	159	1	1	1	1	1	127
1	145	979	827	827	846	154	1320	1563	1563	1563	961	181	186	966	151	984	1245	149	147
149	1489	1490	1489	886	1564	1564	996	996	984	553	541	533	551	550	1303	1303	1303	147	473
463	120	120	120	102	109	121	548	231	1	86	160	147	145	135	1	157	1	1	157
189	179	177	157	202	167	207	197	302	1	1	1	1	1	1	528	472	1	1