Bacteriome.org

Gene Details

gene name: rbsK

Phylogenetic Profile Distribution

locus tag k12	ECK3746	information on phylogenetic profile
locus tag mg1655	b3752
locus tag w3110	JW3731
gene name k12	rbsK
locus name	rbsK
synonyms of locus name

scop id	53613
superfamily	Ribokinase-like
pfam id	PF00294
pfam domain	pfkB family carbohydrate kinase
tigrfam id	TIGR02152
name	D_ribokin_bact
function	ribokinase

swissprot name	RBSK_ECOLI
description	Ribokinase (EC 2.7.1.15).
seq length	309
fastaseq	MQNAGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAF IACTGDDSIGESVRQQLATDNIDITPVSVIKGESTGVALIFVNGEGENVIGIHAGANAAL SPALVEAQRERIANASALLMQLESPLESVMAAAKIAHQNKTIVALNPAPARELPDELLAL VDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLITLGSRGVWASVNGEGQRV PGFRVQAVDTIAAGDTFNGALITALLEEKPLPEAIRFAHAAAAIAVTRKGAQPSVPWREE IDAFLDRQR

go id	GO:0005737; GO:0016052; GO:0016052
go term	cytoplasm; carbohydrate catabolism; carb catab

gene product description	ribokinase
comment gene product description
evidence	E
context
gene product desc	Enzyme
cell location	Cytoplasmic
features	CDS

COG	no information

reference #1	Biochemical and genetical studies on ribose catabolism in Escherichia coli K12. Anderson A., Cooper R. (J Gen Microbiol. 1970 Aug; 62(3):335-9)
reference #2	Ribokinase from Escherichia coli K12. Nucleotide sequence and overexpression of the rbsK gene and purification of ribokinase. Hope J., Bell A., Hermodson M., Groarke J. (J Biol Chem. 1986 Jun 15; 261(17):7663-8)
reference #3	Induced fit on sugar binding activates ribokinase. Sigrell J., Cameron A., Mowbray S. (J Mol Biol. 1999 Jul 30; 290(5):1009-18)
reference #4	Ribokinase from Escherichia coli K12. Nucleotide sequence and overexpression of the rbsK gene and purification of ribokinase. Hope J., Bell A., Hermodson M., Groarke J. (J Biol Chem. 1986 Jun 15; 261(17):7663-8)
reference #5	Purification, characterization, and crystallization of Escherichia coli ribokinase. Sigrell J., Cameron A., Jones T., Mowbray S. (Protein Sci. 1997 Nov; 6(11):2474-6)
reference #6	Structure of Escherichia coli ribokinase in complex with ribose and dinucleotide determined to 1.8 A resolution: insights into a new family of kinase structures. Sigrell J., Cameron A., Jones T., Mowbray S. (Structure. 1998 Feb 15; 6(2):183-93)

phylogenetic profile


79	114	162	153	67	84	79	66	62	68	65	63	1	77	77	79	50	1	1	176
150	150	155	166	125	1	125	125	160	171	178	171	202	1	1	180	1	1	186	193
196	167	187	65	1	1	1	166	1	52	52	1	85	211	192	52	51	1	220	208
163	63	1	56	50	53	51	1	171	1	88	1	1	57	58	1	172	172	174	166
148	154	80	222	195	238	223	236	147	81	84	78	84	80	1	1	1	1	1	1
1	1	156	1	215	214	215	214	215	128	126	1	1	1	1	1	1	1	1	196
1	368	1	1	1	1	67	427	571	572	572	311	66	63	326	87	327	398	219	189
224	518	518	518	256	571	571	322	330	319	1	180	168	156	157	414	414	414	1	59
201	1	1	1	1	1	1	1	189	1	1	204	1	165	81	1	55	53	1	55
116	124	133	118	164	119	189	140	149	181	185	146	164	160	1	152	102	1	1