Bacteriome.org

Gene Details

gene name: polB

Phylogenetic Profile Distribution

locus tag k12	ECK0061	information on phylogenetic profile
locus tag mg1655	b0060
locus tag w3110	JW0059
gene name k12	polB
locus name	polB
synonyms of locus name	dinA

scop id	56672; 53098
superfamily	DNA/RNA polymerases; Ribonuclease H-like
pfam id	PF00136; PF03104
pfam domain	DNA polymerase family B; DNA polymerase family B, exonuclease do
TIGRFAM	no information

swissprot name	DPO2_ECOLI
description	DNA polymerase II (EC 2.7.7.7) (Pol II).
seq length	782
fastaseq	AQAGFILTRHWRDTPQGTEVSFWLATDNGPLQVTLAPQESVAFIPADQVPRAQHILQGEQ GFRLTPLALKDFHRQPVYGLYCRAHRQLMNYEKRLREGGVTVYEADVRPPERYLMERFIT SPVWVEGDMHNGTIVNARLKPHPDYRPPLKWVSIDIETTRHGELYCIGLEGCGQRIVYML GPENGDASSLDFELEYVASRPQLLEKLNAWFANYDPDVIIGWNVVQFDLRMLQKHAERYR LPLRLGRDNSELEWREHGFKNGVFFAQAKGRLIIDGIEALKSAFWNFSSFSLETVAQELL GEGKSIDNPWDRMDEIDRRFAEDKPALATYNLKDCELVTQIFHKTEIMPFLLERATVNGL PVDRHGGSVAAFGHLYFPRMHRAGYVAPNLGEVPPHASPGGYVMDSRPGLYDSVLVLDYK SLYPSIIRTFLIDPVGLVEGMAQPDPEHSTEGFLDAWFSREKHCLPEIVTNIWHGRDEAK RQGNKPLSQALKIIMNAFYGVLGTTACRFFDPRLASSITMRGHQIMRQTKALIEAQGYDV IYGDTDSTFVWLKGAHSEEEAAKIGRALVQHVNAWWAETLQKQRLTSALELEYETHFCRF LMPTIRGADTGSKKRYAGLIQEGDKQRMVFKGLETVRTDWTPLAQQFQQELYLRIFRNEP YQEYVRETIDKLMAGELDARLVYRKRLRRPLSEYQRNVPPHVRAARLADEENQKRGRPLQ YQNRGTIKYVWTTNGPEPLDYQRSPLDYEHYLTRQLQPVAEGILPFIEDNFATLMTGQLG LF

go id	GO:0005737; GO:0006261; GO:0006281; GO:0009314; GO:0009432
go term	cytoplasm; DNA dependent DNA replication; DNA repair; response to radiation; SOS response

gene product description	DNA polymerase II
comment gene product description
evidence	E
context
gene product desc	Enzyme
cell location	Cytoplasmic
features	CDS

functional category code	L
functional category	Replication, recombination and repair

reference #1	DNA polymerase II (polB) is involved in a new DNA repair pathway for DNA interstrand cross-links in Escherichia coli. Berardini M., Foster P., Loechler E. (J Bacteriol. 1999 May; 181(9):2878-82)
reference #2	Nucleotide sequence and deletion analysis of the polB gene of Escherichia coli. Chen H., Sun Y., Stark T., Beattie W., Moses R. (DNA Cell Biol. 1990 Nov; 9(9):631-5)
reference #3	Escherichia coli DNA polymerase II is stimulated by DNA polymerase III holoenzyme auxiliary subunits. Hughes A., Bryan S., Chen H., Moses R., McHenry C. (J Biol Chem. 1991 Mar 5; 266(7):4568-73)
reference #4	A phenotype for enigmatic DNA polymerase II: a pivotal role for pol II in replication restart in UV-irradiated Escherichia coli. Rangarajan S., Woodgate R., Goodman M. (Proc Natl Acad Sci U S A. 1999 Aug 3; 96(16):9224-9)
reference #5	Escherichia coli DNA polymerase II is homologous to alpha-like DNA polymerases. Iwasaki H., Ishino Y., Toh H., Nakata A., Shinagawa H. (Mol Gen Genet. 1991 Apr; 226(1-2):24-33)
reference #6	DNA polymerase II is encoded by the DNA damage-inducible dinA gene of Escherichia coli. Bonner C., Hays S., McEntee K., Goodman M. (Proc Natl Acad Sci U S A. 1990 Oct; 87(19):7663-7)
reference #7	The Escherichia coli polB locus is identical to dinA, the structural gene for DNA polymerase II. Characterization of Pol II purified from a polB mutant. Qiu Z., Goodman M. (J Biol Chem. 1997 Mar 28; 272(13):8611-7)

phylogenetic profile


140	175	99	167	160	147	117	79	139	144	142	145	163	193	175	102	174	184	100	1
1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1
1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1
1	1	1	1	1	1	1	1	1	1	82	1	1	1	1	1	1	1	1	1
1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1
1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1
1	1	1	1	1	1	1	1169	1586	1600	1599	1	1	1	1	1	1	1	1111	1067
1088	1469	1470	1469	604	1603	1603	803	800	807	1	1	1	1	1	1165	1165	1166	1	1
1	1	1	1	1	1	1	65	1	1	1	1	1	1	1	1	1	1	1	1
117	122	107	124	133	123	137	124	144	134	134	132	135	131	149	152	122	113	134