Bacteriome.org

Gene Details

gene name: metH

Phylogenetic Profile Distribution

locus tag k12	ECK4011	information on phylogenetic profile
locus tag mg1655	b4019
locus tag w3110	JW3979
gene name k12	metH
locus name	metH
synonyms of locus name

scop id	51717; 52242; 56507; 47644
superfamily	Dihydropteroate synthetase-like; Cobalamin (vitamin B12)-binding domain; Methionine synthase (activation domain); Methionine synthase domain
pfam id	PF02965; PF02607; PF02310; PF00809; PF02574
pfam domain	Vitamin B12-dep methionine synthase; B12 binding; B12 binding domain; Pterin binding enzyme; Homocysteine S-methyltransferase
tigrfam id	TIGR02082
name	metH
function	5-methyltetrahydrofolate--homocysteine

swissprot name	METH_ECOLI
description	Methionine synthase (EC 2.1.1.13) (5-methyltetrahydrofolate--\|homocysteine methyltransferase) (Methionine synthase, vitamin-B12-\|dependent) (MS).
seq length	1226
fastaseq	SSKVEQLRAQLNERILVLDGGMGTMIQSYRLNEADFRGERFADWPCDLKGNNDLLVLSKP EVIAAIHNAYFEAGADIIETNTFNSTTIAMADYQMESLSAEINFAAAKLARACADEWTAR TPEKPRYVAGVLGPTNRTASISPDVNDPAFRNITFDGLVAAYRESTKALVEGGADLILIE TVFDTLNAKAAVFAVKTEFEALGVELPIMISGTITDASGRTLSGQTTEAFYNSLRHAEAL TFGLNCALGPDELRQYVQELSRIAECYVTAHPNAGLPNAFGEYDLDADTMAKQIREWAQA GFLNIVGGCCGTTPQHIAAMSRAVEGLAPRKLPEIPVACRLSGLEPLNIGEDSLFVNVGE RTNVTGSAKFKRLIKEEKYSEALDVARQQVENGAQIIDINMDEGMLDAEAAMVRFLNLIA GEPDIARVPIMIDSSKWDVIEKGLKCIQGKGIVNSISMKEGVDAFIHHAKLLRRYGAAVV VMAFDEQGQADTRARKIEICRRAYKILTEEVGFPPEDIIFDPNIFAVATGIEEHNNYAQD FIGACEDIKRELPHALISGGVSNVSFSFRGNDPVREAIHAVFLYYAIRNGMDMGIVNAGQ LAIYDDLPAELRDAVEDVILNRRDDGTERLLELAEKYRGSKTDDTANAQQAEWRSWEVNK RLEYSLVKGITEFIEQDTEEARQQATRPIEVIEGPLMDGMNVVGDLFGEGKMFLPQVVKS ARVMKQAVAYLEPFIEASKEQGKTNGKMVIATVKGDVHDIGKNIVGVVLQCNNYEIVDLG VMVPAEKILRTAKEVNADLIGLSGLITPSLDEMVNVAKEMERQGFTIPLLIGGATTSKAH TAVKIEQNYSGPTVYVQNASRTVGVVAALLSDTQRDDFVARTRKEYETVRIQHGRKKPRT PPVTLEAARDNDFAFDWQAYTPPVAHRLGVQEVEASIETLRNYIDWTPFFMTWSLAGKYP RILEDEVVGVEAQRLFKDANDMLDKLSAEKTLNPRGVVGLFPANRVGDDIEIYRDETRTH VINVSHHLRQQTEKTGFANYCLADFVAPKLSGKADYIGAFAVTGGLEEDALADAFEAQHD DYNKIMVKALADRLAEAFAEYLHERVRKVYWGYAPNENLSNEELIRENYQGIRPAPGYPA CPEHTEKATIWELLEVEKHTGMKLTESFAMWPGASVSGWYFSHPDSKYYAVAQIQRDQVE DYARRKGMSVTEVERWLAPNLGYDAD

go id	GO:0009086; GO:0009257; GO:0009257; GO:0009236; GO:0006556; GO:0009257
go term	methionine biosynthesis; 10-formyltetrahydrofolate biosynthesis; 10-formylTHF biosyn; vitamin B12 biosynthesis; S-adenosylmethionine biosynthesis; 10-formylTHF biosynth

gene product description	homocysteine-N5-methyltetrahydrofolate transmethylase, B12-dependent
comment gene product description
evidence	E
context
gene product desc	Enzyme
cell location	Cytoplasmic
features	CDS

functional category code	E
functional category	Amino acid transport and metabolism

reference #1	Domain alternation switches B(12)-dependent methionine synthase to the activation conformation. Bandarian V., Pattridge K., Lennon B., Huddler D., Matthews R., Ludwig M. (Nat Struct Biol. 2002 Jan; 9(1):53-6)
reference #2	Cloning and sequence analysis of the Escherichia coli metH gene encoding cobalamin-dependent methionine synthase and isolation of a tryptic fragment containing the cobalamin-binding domain. Banerjee R., Johnston N., Sobeski J., Datta P., Matthews R. (J Biol Chem. 1989 Aug 15; 264(23):13888-95)
reference #3	Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes. Blattner F., Burland V., Plunkett G., Sofia H., Daniels D. (Nucleic Acids Res. 1993 Nov 25; 21(23):5408-17)
reference #4	Crystallization and preliminary X-ray diffraction studies of the cobalamin-binding domain of methionine synthase from Escherichia coli. Luschinsky C., Drummond J., Matthews R., Ludwig M. (J Mol Biol. 1992 May 20; 225(2):557-60)
reference #5	Nucleotide sequence of the metH gene of Escherichia coli K-12 and comparison with that of Salmonella typhimurium LT2. Old I., Margarita D., Glass R., Saint Girons I. (Gene. 1990 Mar 1; 87(1):15-21)
reference #6	Cobalamin-dependent methionine synthase. Banerjee R., Matthews R. (FASEB J. 1990 Mar; 4(5):1450-9)
reference #7	Cloning and sequence analysis of the Escherichia coli metH gene encoding cobalamin-dependent methionine synthase and isolation of a tryptic fragment containing the cobalamin-binding domain. Banerjee R., Johnston N., Sobeski J., Datta P., Matthews R. (J Biol Chem. 1989 Aug 15; 264(23):13888-95)
reference #8	How a protein binds B12: A 3.0 A X-ray structure of B12-binding domains of methionine synthase. Drennan C., Huang S., Drummond J., Matthews R., Lidwig M. (Science. 1994 Dec 9; 266(5191):1669-74)
reference #9	Electrospray mass spectrometric analysis of the domains of a large enzyme: observation of the occupied cobalamin-binding domain and redefinition of the carboxyl terminus of methionine synthase. Drummond J., Loo R., Matthews R. (Biochemistry. 1993 Sep 14; 32(36):9282-9)
reference #10	The structure of the C-terminal domain of methionine synthase: presenting S-adenosylmethionine for reductive methylation of B12. Dixon M., Huang S., Matthews R., Ludwig M. (Structure. 1996 Nov 15; 4(11):1263-75)
reference #11	Two enzymic mechanisms for the methylation of homocysteine by extracts of Escherichia coli. Foster M., Tejerina G., Guest J., Woods D. (Biochem J. 1964 Sep; 92(3):476-88)

phylogenetic profile


1	1	1	1	115	1	52	1	105	1	122	122	1	1	1	1	1	1	1	1
568	544	533	1	536	532	447	535	560	1	552	566	381	1	1	1455	1	1	1440	1471
1472	1074	142	1468	1	1	1	1464	1	1433	1430	1431	1	1064	1543	1	1	1507	1068	581
553	518	502	528	551	572	577	1	318	315	346	1	1	1	1	475	726	731	727	737
731	130	1252	75	308	1	1	122	1	130	128	128	128	128	1	1	1	1	1	1
1	1	60	1	109	111	110	111	110	124	124	118	1	1	1	1	1	1	1	354
1	1513	1	1	1	1	1	2096	2401	2408	2406	1	1	1	1558	1683	1	1	1622	1599
1603	2326	2332	2326	1608	2394	2395	1853	1825	1846	1	1108	1111	1	1	2097	2097	2098	1	1043
1049	1	1	1	1	1	1	1455	1343	213	1	1318	1	289	584	1	1414	1	1	1414
54	1	1	1	1	1	1	1	410	1251	1253	60	1264	1173	1	85	1	1	1