Bacteriome.org

Gene Details

gene name: ileS

Phylogenetic Profile Distribution

locus tag k12	ECK0027	information on phylogenetic profile
locus tag mg1655	b0026
locus tag w3110	JW0024
gene name k12	ileS
locus name	ileS
synonyms of locus name	ilvS

scop id	50677; 47323; 52374
superfamily	ValRS/IleRS editing domain; Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases; Nucleotidylyl transferase
pfam id	PF06827; PF00133
pfam domain	Zinc finger found in FPG and IleRS; tRNA synthetases class I (I, L, M and V)
tigrfam id	TIGR00392
name	ileS
function	isoleucyl-tRNA synthetase

swissprot name	SYI_ECOLI
description	Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA ligase)\|(IleRS).
seq length	937
fastaseq	SDYKSTLNLPETGFPMRGDLAKREPGMLARWTDDDLYGIIRAAKKGKKTFILHDGPPYAN GSIHIGHSVNKILKDIIVKSKGLSGYDSPYVPGWDCHGLPIELKVEQEYGKPGEKFTAAE FRAKCREYAATQVDGQRKDFIRLGVLGDWSHPYLTMDFKTEANIIRALGKIIGNGHLHKG AKPVHWCVDCRSALAEAEVEYYDKTSPSIDVAFQAVDQDALKAKFAVSNVNGPISLVIWT TTPWTLPANRAISIAPDFDYALVQIDGQAVILAKDLVESVMQRIGVTDYTILGTVKGAEL ELLRFTHPFMGFDVPAILGDHVTLDAGTGAVHTAPGHGPDDYVIGQKYGLETANPVGPDG TYLPGTYPTLDGVNVFKANDIVVALLQEKGALLHVEKMQHSYPCCWRHKTPIIFRATPQW FVSMDQKGLRAQSLKEIKGVQWIPDWGQARIESMVANRPDWCISRQRTWGVPMSLFVHKD TEELHPRTLELMEEVAKRVEVDGIQAWWDLDAKEILGDEADQYVKVPDTLDVWFDSGSTH SSVVDVRPEFAGHAADMYLEGSDQHRGWFMSSLMISTAMKGKAPYRQVLTHGFTVDGQGR KMSKSIGNTVSPQDVMNKLGADILRLWVASTDYTGEMAVSDEILKRAADSYRRIRNTARF LLANLNGFDPAKDMVKPEEMVVLDRWAVGCAKAAQEDILKAYEAYDFHEVVQRLMRFCSV EMGSFYLDIIKDRQYTAKADSVARRSCQTALYHIAEALVRWMAPILSFTADEVWGYLPGE REKYVFTGEWYEGLFGLADSEAMNDAFWDELLKVRGEVNKVIEQARADKKVGGSLEAAVT LYAEPELSAKLTALGDELRFVLLTSGATVADYNDAPADAQQSEVLKGLKVALSKAEGEKC PRCWHYTQDVGKVAEHAEICGRCVSNVAGDGEKRKFA

go id	GO:0005737; GO:0006418
go term	cytoplasm; amino acid activation

gene product description	isoleucyl-tRNA synthetase
comment gene product description
evidence	E
context
gene product desc	Enzyme
cell location	Cytoplasmic
features	CDS

functional category code	J
functional category	Translation, ribosomal structure and biogenesis

reference #1	Nuclear overhauser effect studies of the conformations of Mg(alpha, beta-methylene)ATP bound to E. coli isoleucyl-tRNA synthetase. Williams J., Rosevear P. (Biochem Biophys Res Commun. 1991 Apr 30; 176(2):682-9)
reference #2	Mechanisms of molecular recognition of tRNAs by aminoacyl-tRNA synthetases. Nureki O., Tateno M., Niimi T., Kohno T., Muramatsu T., Kanno H., Muto Y., Giege R., Yokoyama S.
reference #3	Characterization of the ileS-lsp operon in Escherichia coli. Identification of an open reading frame upstream of the ileS gene and potential promoter(s) for the ileS-lsp operon. Kamio Y., Lin C., Regue M., Wu H. (J Biol Chem. 1985 May 10; 260(9):5616-20)
reference #4	Nucleotide sequence of the Escherichia coli prolipoprotein signal peptidase (lsp) gene. Innis M., Tokunaga M., Williams M., Loranger J., Chang S., Chang S., Wu H. (Proc Natl Acad Sci U S A. 1984 Jun; 81(12):3708-12)
reference #5	Nucleotide sequence of the lspA gene, the structural gene for lipoprotein signal peptidase of Escherichia coli. Yu F., Yamada H., Daishima K., Mizushima S. (FEBS Lett. 1984 Jul 23; 173(1):264-8)
reference #6	Specific sequence homology and three-dimensional structure of an aminoacyl transfer RNA synthetase. Webster T., Tsai H., Kula M., Mackie G., Schimmel P. (Science. 1984 Dec 14; 226(4680):1315-7)
reference #7	Relationship of protein structure of isoleucyl-tRNA synthetase with pseudomonic acid resistance of Escherichia coli. A proposed mode of action of pseudomonic acid as an inhibitor of isoleucyl-tRNA synthetase. Yanagisawa T., Lee J., Wu H., Kawakami M. (J Biol Chem. 1994 Sep 30; 269(39):24304-9)
reference #8	Enzyme structure with two catalytic sites for double-sieve selection of substrate. Nureki O., Vassylyev D., Tateno M., Shimada A., Nakama T., Fukai S., Konno M., Hendrickson T., Schimmel P., Yokoyama S. (Science. 1998 Apr 24; 280(5363):578-82)
reference #9	Nucleotide sequence of the lsp-dapB interval in Escherichia coli. Bouvier J., Stragier P. (Nucleic Acids Res. 1991 Jan 11; 19(1):180)

phylogenetic profile


401	322	391	357	439	382	450	430	376	451	432	425	291	408	410	405	317	315	269	250
286	295	305	259	306	277	306	306	294	303	329	333	792	271	271	679	634	635	707	672
670	686	662	700	303	295	297	662	278	979	979	976	937	938	1042	1003	1000	1017	949	755
706	675	715	681	749	698	763	338	852	880	901	629	671	616	627	653	808	808	805	811
819	792	310	308	319	780	746	709	737	797	795	792	796	793	561	502	560	564	565	555
491	625	766	611	755	757	755	757	755	699	698	693	697	694	708	712	706	708	708	871
565	1070	1051	993	1097	1108	1112	1605	1910	1910	1910	167	1080	1077	1329	1216	1331	1585	1094	1097
1067	1689	1693	1689	1379	1915	1912	1339	1366	1353	1025	1071	1068	1051	1042	1650	1650	1650	780	273
256	294	293	293	288	290	295	304	261	818	298	284	266	781	323	269	713	315	298	715
481	538	506	514	483	498	489	555	453	390	445	460	577	570	252	692	682	136	215