Bacteriome.org

Gene Details

gene name: frwD

Phylogenetic Profile Distribution

locus tag k12	ECK3944	information on phylogenetic profile
locus tag mg1655	b3953
locus tag w3110	JW3925
gene name k12	frwD
locus name	frwD
synonyms of locus name	yijN

SCOP	no information
pfam id	PF02379
pfam domain	PTS system, Fructose specific IIB subuni
tigrfam id	TIGR00829
name	FRU
function	PTS system, fructose-specific, II

swissprot name	PTFB3_ECOLI
description	Fructose-like phosphotransferase enzyme IIB component 3 (EC 2.7.1.69)\|(PTS system fructose-like EIIB component 3).
seq length	113
fastaseq	MAYLVAVTACVSGVAHTYMAAERLEKLCLLEKWGVSIETQGALGTENRLADEDIRRADVA LLITDIELAGAERFEHCRYVQCSIYAFLREPQRVMSAVRKVLSAPQQTHLILE

go id	GO:0016052; GO:0016052
go term	carbohydrate catabolism; carb catab

gene product description	predicted enzyme IIB component of PTS
comment gene product description
evidence	C
context
gene product desc	Transporter, predicted
cell location	Periplasmic
features	CDS

COG	no information

reference #1	Cloning of a gene from Escherichia coli that confers resistance to fosmidomycin as a consequence of amplification. Fujisaki S., Ohnuma S., Horiuchi T., Takahashi I., Tsukui S., Nishimura Y., Nishino T., Kitabatake M., Inokuchi H. (Gene. 1996 Oct 10; 175(1-2):83-7)

phylogenetic profile


1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1
1	1	1	50	1	1	1	1	62	68	54	53	73	1	1	1	1	1	1	1
1	1	1	1	1	1	1	1	1	1	1	1	1	1	85	1	1	1	60	1
1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	60	58	58	58
66	70	59	68	1	62	60	58	70	73	72	78	76	78	72	59	56	59	66	61
62	61	57	1	62	62	62	62	62	62	62	65	77	65	65	65	65	65	65	66
1	68	1	1	1	1	1	79	221	221	222	63	1	1	68	1	62	67	64	69
66	65	182	65	1	221	221	75	79	75	1	62	63	1	1	127	127	127	1	1
1	1	1	1	1	1	1	1	70	1	1	1	1	1	1	68	1	1	1	1
1	1	1	1	1	1	1	1	75	1	1	1	1	1	1	1	1	1	1