Bacteriome.org

Gene Details

gene name: flgD

Phylogenetic Profile Distribution

locus tag k12	ECK1060	information on phylogenetic profile
locus tag mg1655	b1075
locus tag w3110	JW1062
gene name k12	flgD
locus name	flgD
synonyms of locus name	flaV, fla FIV, fla FVI

SCOP	no information
pfam id	PF03963
pfam domain	Flagellar hook capping protein
TIGRFAM	no information

swissprot name	FLGD_ECOLI
description	Basal-body rod modification protein flgD.
seq length	231
fastaseq	MSIAVTTTDPTNTGVSTTSSSSLTGSNAADLQSSFLTLLVAQLKNQDPTNPMENNELTSQ LAQISTVSGIEKLNTTLGSISGQIDNSQSLQASNLIGHGVMIPGTTVLAGTGSEEGAVTT TTPFGVELQQAADKVTATITDKNGAVVRTIDIGELTAGVHSFTWDGTLTDGSTAPNGSYN VAISASNGGTQLVAQPLQFALVQGVIRGNSGNTLDLGTYGTTTLDEVRQII

go id	GO:0019861; GO:0042330; GO:0009296
go term	flagellum; taxis; flagella biogenesis

gene product description	flagellar hook assembly protein
comment gene product description
evidence	E
context
gene product desc	Structural component
cell location	Periplasmic
features	CDS

functional category code	N
functional category	Cell motility

reference #1	Genetics and biogenesis of bacterial flagella. Macnab R.
reference #2	New unified nomenclature for the flagellar genes of Escherichia coli and Salmonella typhimurium. Iino T., Komeda Y., Kutsukake K., Macnab R., Matsumura P., Parkinson J., Simon M., Yamaguchi S. (Microbiol Rev. 1988 Dec; 52(4):533-5)

phylogenetic profile


1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1
1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	57	1	1	62	56
56	66	55	85	1	1	1	51	1	176	176	174	141	146	125	1	1	145	149	1
1	1	1	1	1	1	1	93	106	75	98	61	52	55	55	51	1	1	1	51
1	1	1	1	1	1	1	1	1	54	55	55	55	55	1	1	1	1	1	1
1	1	50	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	51
1	1	1	1	161	139	1	244	378	380	381	1	111	111	1	1	1	221	111	104
100	330	330	330	87	381	381	109	105	106	91	109	110	1	1	263	263	267	1	1
1	1	1	1	1	1	1	1	1	1	1	56	1	80	1	1	1	1	1	1
1	1	1	1	1	1	1	1	90	1	1	1	1	1	1	1	1	1	1