Bacteriome.org

Gene Details

gene name: aroC

Phylogenetic Profile Distribution

locus tag k12	ECK2323	information on phylogenetic profile
locus tag mg1655	b2329
locus tag w3110	JW2326
gene name k12	aroC
locus name	aroC
synonyms of locus name

SCOP	no information
pfam id	PF01264
pfam domain	Chorismate synthase
tigrfam id	TIGR00033
name	aroC
function	chorismate synthase

swissprot name	AROC_ECOLI
description	Chorismate synthase (EC 4.2.3.5) (5-enolpyruvylshikimate-3-phosphate\|phospholyase).
seq length	360
fastaseq	AGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRRE PDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDYR GGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIKDWSQVEQNPFFCP DPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSINAVK GVEIGDGFDVVALRGSQNRDEITKDGFQSNHAGGILGGISSGQQIIAHMALKPTSSITVP GRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRAQNADVKTDIPRW

go id	GO:0009423
go term	chorismate biosynthesis

gene product description	chorismate synthase
comment gene product description
evidence	E
context
gene product desc	Enzyme
cell location	Cytoplasmic
features	CDS

functional category code	E
functional category	Amino acid transport and metabolism

reference #1	The overexpression, purification and complete amino acid sequence of chorismate synthase from Escherichia coli K12 and its comparison with the enzyme from Neurospora crassa. White P., Millar G., Coggins J. (Biochem J. 1988 Apr 15; 251(2):313-22)
reference #2	Isolation, characterization and nucleotide sequences of the aroC genes encoding chorismate synthase from Salmonella typhi and Escherichia coli. Charles I., Lamb H., Pickard D., Dougan G., Hawkins A. (J Gen Microbiol. 1990 Feb; 136(2):353-8)
reference #3	Isolation, characterization and nucleotide sequences of the aroC genes encoding chorismate synthase from Salmonella typhi and Escherichia coli. Charles I., Lamb H., Pickard D., Dougan G., Hawkins A. (J Gen Microbiol. 1990 Feb; 136(2):353-8)
reference #4	The overexpression, purification and complete amino acid sequence of chorismate synthase from Escherichia coli K12 and its comparison with the enzyme from Neurospora crassa. White P., Millar G., Coggins J. (Biochem J. 1988 Apr 15; 251(2):313-22)

phylogenetic profile


257	219	262	266	319	239	301	289	268	300	327	337	201	248	218	1	249	243	1	167
179	176	177	162	164	159	164	164	166	167	173	175	180	166	166	389	381	384	427	401
401	387	385	426	1	1	1	384	1	440	437	441	469	468	456	450	451	455	435	318
147	300	280	290	285	321	322	219	281	360	180	288	317	276	280	325	182	182	182	177
177	169	234	216	126	172	1	167	152	175	173	174	111	174	1	1	1	1	1	1
1	1	162	1	145	144	143	144	143	171	171	162	168	168	181	181	178	177	137	147
1	477	476	470	495	494	446	608	690	690	690	520	450	449	519	494	525	596	494	489
487	661	665	661	1	687	687	554	553	556	1	435	428	412	412	594	594	592	174	298
292	259	259	259	260	252	239	175	147	211	286	208	310	155	149	1	301	243	1	301
280	270	278	285	259	283	270	284	1	1	1	1	1	1	1	305	323	1	140