Bacteriome.org

Gene Details

gene name: aceF

Phylogenetic Profile Distribution

locus tag k12	ECK0114	information on phylogenetic profile
locus tag mg1655	b0115
locus tag w3110	JW0111
gene name k12	aceF
locus name	aceF
synonyms of locus name

scop id	47005; 52777; 51230
superfamily	Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex; CoA-dependent acyltransferases; Single hybrid motif
pfam id	PF00198; PF02817; PF00364
pfam domain	2-oxoacid dehydrogenases acyltransferase (catalytic domain); e3 binding domain; Biotin-requiring enzyme
tigrfam id	TIGR01348
name	PDHac_trf_long
function	pyruvate dehydrogenase

swissprot name	ODP2_ECOLI
description	Dihydrolipoyllysine-residue acetyltransferase component of pyruvate\|dehydrogenase complex (EC 2.3.1.12) (E2) (Dihydrolipoamide\|acetyltransferase component of pyruvate dehydrogenase complex).
seq length	629
fastaseq	AIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGIVKEIKVSV GDKTQTGALIMIFDSADGAADAAPAQAEEKKEAAPAAAPAAAAAKDVNVPDIGSDEVEVT EILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNVGDKVSTGSLIMVFEVAG EAGAAAPAAKQEAAPAAAPAPAAGVKEVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLITV EGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVEGAAPAAAPAKQEAAAPAPAA KAEAPAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDV QAYVKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWV MIPHVTHFDKTDITELEAFRKQQNEEAAKRKLDVKITPVVFIMKAVAAALEQMPRFNSSL SEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMTISKKARDGKLTAG EMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPISLSF DHRVIDGADGARFITIINNTLSDIRRLVM

go id	GO:0016052; GO:0006096; GO:0006086; GO:0009436; GO:0009061; GO:0016052; GO:0006086; GO:0009061; GO:0009436
go term	carbohydrate catabolism; glycolysis; acetyl-CoA biosynthesis from pyruvate; glyoxylate catabolism; anaerobic respiration; carb catab; acetyl-CoA biosyn; anaerobic resp; glyoxylate catab

gene product description	pyruvate dehydrogenase, dihydrolipoyltransacetylase component E2
comment gene product description
evidence	E
context
gene product desc	Enzyme
cell location
features	CDS

functional category code	C
functional category	Energy production and conversion

reference #1	Molecular weight and symmetry of the pyruvate dehydrogenase multienzyme complex of Escherichia coli. Danson M., Hale G., Johnson P., Perham R., Smith J., Spragg P. (J Mol Biol. 1979 Apr 25; 129(4):603-17)
reference #2	The catalytic domain of the dihydrolipoyl transacetylase component of the pyruvate dehydrogenase complex from Azotobacter vinelandii and Escherichia coli. Expression, purification, properties and preliminary X-ray analysis. Schulze E., Westphal A., Obmolova G., Mattevi A., Hol W., de Kok A. (Eur J Biochem. 1991 Nov 1; 201(3):561-8)
reference #3	Purification and cellular localization of wild type and mutated dihydrolipoyltransacetylases from Azotobacter vinelandii and Escherichia coli expressed in E. coli. Schulze E., Westphal A., Veenhuis M., de Kok A. (Biochim Biophys Acta. 1992 Mar 27; 1120(1):87-96)
reference #4	Isolation and characterization of lipoylated and unlipoylated domains of the E2p subunit of the pyruvate dehydrogenase complex of Escherichia coli. Ali S., Guest J. (Biochem J. 1990 Oct 1; 271(1):139-45)
reference #5	Overexpression of restructured pyruvate dehydrogenase complexes and site-directed mutagenesis of a potential active-site histidine residue. Russell G., Guest J. (Biochem J. 1990 Jul 15; 269(2):443-50)
reference #6	The pyruvate dehydrogenase complex of Escherichia coli K12. Nucleotide sequence encoding the dihydrolipoamide acetyltransferase component. Stephens P., Darlison M., Lewis H., Guest J. (Eur J Biochem. 1983 Jul 1; 133(3):481-9)
reference #7	Amino acid sequence around lipoic acid residues in the pyruvate dehydrogenase multienzyme complex of Escherichia coli. Hale G., Perham R. (Biochem J. 1980 Jun 1; 187(3):905-8)
reference #8	Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12. Link A., Robison K., Church G. (Electrophoresis. 1997 Aug; 18(8):1259-313)

phylogenetic profile


206	207	120	1	1	194	1	1	1	1	1	1	157	1	1	1	181	187	1	1
237	200	233	136	174	179	174	174	155	172	155	150	223	141	142	188	172	169	410	201
200	164	197	186	170	179	172	197	156	475	480	471	475	476	456	465	466	365	464	117
105	107	108	108	105	103	110	289	109	1	205	1	1	1	1	1	223	226	224	242
227	221	1	1	1	235	1	209	214	261	263	264	263	263	128	115	134	130	208	171
112	141	234	222	222	221	223	221	223	162	163	151	149	149	145	146	147	146	146	175
1	422	411	316	366	372	396	903	159	959	959	641	428	429	771	375	762	708	446	450
439	922	922	922	585	956	957	748	753	751	382	345	350	452	447	711	711	715	1	160
153	172	172	172	148	144	152	1	277	1	145	218	1	1	303	1	160	1	1	160
135	132	128	137	152	133	139	176	144	159	160	174	145	150	1	152	143	1	131